PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I00224.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bZIP
Protein Properties Length: 416aa    MW: 44596.8 Da    PI: 6.2538
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I00224.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.53.8e-10264316557
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                     kr +r   NR +A rs +RK  +i+eLe+kv+ L++e ++L  +l  l+  +a
  Pahal.I00224.1 264 KRVKRVLANRQSAARSKERKMRYIAELEQKVQILQTEATTLSAQLTLLQRDSA 316
                     999*****************************************999987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.8E-16260324IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.553262325IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.18E-11264314No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-10264316No hitNo description
PfamPF001702.7E-9264316IPR004827Basic-leucine zipper domain
CDDcd147034.65E-24265316No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MNGVGDAHAA AMMQHQVQAR VQQQQQLGVS LPMATSFAPE PASAKPRPPG LPPTPPPAFG  60
GQRPSPGDAC MEVDATAARK AHHRRSRSDV PFGYFPPASG GVQLPPPKVE AGWGHHGGDA  120
DDLFNAYLNL EGLDGLNSSD ERHDDGDSRG SSMKTNGADS SENESEECAA DSRAGIRLWG  180
GEGLKRSAAG EPAGAPMARH ARSLSMDSLI GKLNFSAGAT ANGGVMPGPN RFSLEFGSGE  240
FTPVEMKKIM ADEKLTEMAL ADPKRVKRVL ANRQSAARSK ERKMRYIAEL EQKVQILQTE  300
ATTLSAQLTL LQRDSAGIAT QNNELKFRLQ AMEQQAQLRD ALNEALTAEV QRLKLATAEL  360
GDSCSSNNLA QQLQLSAQDQ MFQLQHQQQQ ATPIPFYQLQ QAQQNGAGKN QDPTE*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715090.0EU971509.1 Zea mays clone 366380 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985885.10.0PREDICTED: transcription factor RF2b-like
TrEMBLK4AAD40.0K4AAD4_SETIT; Uncharacterized protein
STRINGSi035841m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.38e-66bZIP family protein